PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0049s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family HSF
Protein Properties Length: 84aa    MW: 9273.43 Da    PI: 4.0067
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0049s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind28.83.2e-094076137
                         HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHH CS
         HSF_DNA-bind  1 aFlkklyeiledeelkeliswsengnsfvvldeeefa 37
                         +Fl+klyei++d++++ l++w  +g+sfvv+d + f 
  Kaladp0049s0010.1.p 40 QFLSKLYEIVDDPNTDYLVQWGFDGQSFVVHDANAFC 76
                         69********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.7E-103377IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.22E-83777IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004475.8E-74177IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MVADVANIGQ GIDVVPSCFS QEVILPRPTH EKLREIGVPQ FLSKLYEIVD DPNTDYLVQW  60
GFDGQSFVVH DANAFCDYSS QVL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651810.15e-15PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor A-2a-like
SwissprotQ84MN73e-16HFA2A_ORYSJ; Heat stress transcription factor A-2a
TrEMBLA0A0E0KIX55e-15A0A0E0KIX5_ORYPU; Uncharacterized protein
TrEMBLJ3LSR33e-15J3LSR3_ORYBR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51910.11e-11heat shock transcription factor A7A